PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000054.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 270aa    MW: 30253.5 Da    PI: 8.4606
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000054.1_g00015.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM142.62.3e-4471372128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                               pGfrF Pt+eelv++yL+ k+eg++ ++++vi+ ++iy++ePw+Lp+     ++++ ++w+fF++r++++a+g r+ r+t++gyW
  Itr_sc000054.1_g00015.1   7 SPGFRFYPTEEELVSFYLHTKLEGNRPDIDRVIPALNIYDLEPWQLPRvsgeLCAGDMEQWFFFVPRQEREARGGRPCRTTATGYW 92 
                              69***************************99****************545643344677*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+   v+s++++++g+kk++vfy+g+ap g+kt+W m+eyr+
  Itr_sc000054.1_g00015.1  93 KATGSPSYVYSSGNKVIGVKKSMVFYNGKAPCGRKTKWKMNEYRA 137
                              *******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100546.7296168IPR003441NAC domain
SuperFamilySSF1019414.05E-476166IPR003441NAC domain
PfamPF023654.4E-238136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGAEIISPGF RFYPTEEELV SFYLHTKLEG NRPDIDRVIP ALNIYDLEPW QLPRVSGELC  60
AGDMEQWFFF VPRQEREARG GRPCRTTATG YWKATGSPSY VYSSGNKVIG VKKSMVFYNG  120
KAPCGRKTKW KMNEYRAIEE VVLPATSSST ATVPKLRHEM SLCRIYVISG SFRAFDRRPI  180
GAPPSLQRRE SGSGSSNINI NININDDDGK TLMELETSNK SSPPLLSASL MDQQCDGGRS  240
MKMESTTTNL NLCTMVKNLE PICHDWMGKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A8e-33616620166NAC domain-containing protein 19
3swm_B8e-33616620166NAC domain-containing protein 19
3swm_C8e-33616620166NAC domain-containing protein 19
3swm_D8e-33616620166NAC domain-containing protein 19
3swp_A8e-33616620166NAC domain-containing protein 19
3swp_B8e-33616620166NAC domain-containing protein 19
3swp_C8e-33616620166NAC domain-containing protein 19
3swp_D8e-33616620166NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015057943.11e-106PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR35e-83NAC90_ARATH; NAC domain-containing protein 90
TrEMBLK4DA191e-106K4DA19_SOLLC; Uncharacterized protein
STRINGSolyc11g068620.1.11e-105(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.13e-84NAC domain containing protein 90